Anti PAPLN pAb (ATL-HPA053453)

Atlas Antibodies

SKU:
ATL-HPA053453-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: papilin, proteoglycan-like sulfated glycoprotein
Gene Name: PAPLN
Alternative Gene Name: MGC50452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021223: 67%, ENSRNOG00000009448: 69%
Entrez Gene ID: 89932
Uniprot ID: O95428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACSLEDRPPLTEPCVHEDCPLLSDQAWHVGTWGLCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQDVHTPA
Gene Sequence ACSLEDRPPLTEPCVHEDCPLLSDQAWHVGTWGLCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQDVHTPA
Gene ID - Mouse ENSMUSG00000021223
Gene ID - Rat ENSRNOG00000009448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PAPLN pAb (ATL-HPA053453)
Datasheet Anti PAPLN pAb (ATL-HPA053453) Datasheet (External Link)
Vendor Page Anti PAPLN pAb (ATL-HPA053453) at Atlas Antibodies

Documents & Links for Anti PAPLN pAb (ATL-HPA053453)
Datasheet Anti PAPLN pAb (ATL-HPA053453) Datasheet (External Link)
Vendor Page Anti PAPLN pAb (ATL-HPA053453)