Anti PAPD7 pAb (ATL-HPA045487)

Atlas Antibodies

SKU: ATL-HPA045487-25

• 
• 

Protein Description: PAP associated domain containing 7
Gene Name: PAPD7
Alternative Gene Name: LAK-1, POLK, POLS, TRF4, TRF4-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034575: 96%, ENSRNOG00000017613: 95%
Entrez Gene ID: 11044
Uniprot ID: Q5XG87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
• Gene Sequence: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
• Gene ID - Mouse: ENSMUSG00000034575
• Gene ID - Rat: ENSRNOG00000017613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.