Anti PAPD4 pAb (ATL-HPA054468)
Atlas Antibodies
- SKU:
- ATL-HPA054468-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PAPD4
Alternative Gene Name: FLJ38499, GLD2, TUT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042167: 89%, ENSRNOG00000012099: 89%
Entrez Gene ID: 167153
Uniprot ID: Q6PIY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT |
Gene Sequence | HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT |
Gene ID - Mouse | ENSMUSG00000042167 |
Gene ID - Rat | ENSRNOG00000012099 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAPD4 pAb (ATL-HPA054468) | |
Datasheet | Anti PAPD4 pAb (ATL-HPA054468) Datasheet (External Link) |
Vendor Page | Anti PAPD4 pAb (ATL-HPA054468) at Atlas Antibodies |
Documents & Links for Anti PAPD4 pAb (ATL-HPA054468) | |
Datasheet | Anti PAPD4 pAb (ATL-HPA054468) Datasheet (External Link) |
Vendor Page | Anti PAPD4 pAb (ATL-HPA054468) |