Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052794-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-PALM3 antibody. Corresponding PALM3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: paralemmin 3
Gene Name: PALM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047986: 85%, ENSRNOG00000005729: 83%
Entrez Gene ID: 342979
Uniprot ID: A6NDB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPTSKDPQSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIV
Gene Sequence DPTSKDPQSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIV
Gene ID - Mouse ENSMUSG00000047986
Gene ID - Rat ENSRNOG00000005729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation)
Datasheet Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation)
Datasheet Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PALM3 pAb (ATL-HPA052794 w/enhanced validation)