Protein Description: paralemmin 2
Gene Name: PALM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090053: 87%, ENSRNOG00000025558: 87%
Entrez Gene ID: 114299
Uniprot ID: Q8IXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PALM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090053: 87%, ENSRNOG00000025558: 87%
Entrez Gene ID: 114299
Uniprot ID: Q8IXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ |
| Documents & Links for Anti PALM2 pAb (ATL-HPA074153) | |
| Datasheet | Anti PALM2 pAb (ATL-HPA074153) Datasheet (External Link) |
| Vendor Page | Anti PALM2 pAb (ATL-HPA074153) at Atlas |
| Documents & Links for Anti PALM2 pAb (ATL-HPA074153) | |
| Datasheet | Anti PALM2 pAb (ATL-HPA074153) Datasheet (External Link) |
| Vendor Page | Anti PALM2 pAb (ATL-HPA074153) |