Anti PALM2 pAb (ATL-HPA074153)
Atlas Antibodies
- SKU:
- ATL-HPA074153-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PALM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090053: 87%, ENSRNOG00000025558: 87%
Entrez Gene ID: 114299
Uniprot ID: Q8IXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ |
Gene Sequence | TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ |
Gene ID - Mouse | ENSMUSG00000090053 |
Gene ID - Rat | ENSRNOG00000025558 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PALM2 pAb (ATL-HPA074153) | |
Datasheet | Anti PALM2 pAb (ATL-HPA074153) Datasheet (External Link) |
Vendor Page | Anti PALM2 pAb (ATL-HPA074153) at Atlas Antibodies |
Documents & Links for Anti PALM2 pAb (ATL-HPA074153) | |
Datasheet | Anti PALM2 pAb (ATL-HPA074153) Datasheet (External Link) |
Vendor Page | Anti PALM2 pAb (ATL-HPA074153) |