Anti PAIP2B pAb (ATL-HPA072371)

Atlas Antibodies

SKU: ATL-HPA072371-25

• 

Protein Description: poly(A) binding protein interacting protein 2B
Gene Name: PAIP2B
Alternative Gene Name: KIAA1155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045896: 80%, ENSRNOG00000014092: 80%
Entrez Gene ID: 400961
Uniprot ID: Q9ULR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSDLNPDA
• Gene Sequence: IPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSDLNPDA
• Gene ID - Mouse: ENSMUSG00000045896
• Gene ID - Rat: ENSRNOG00000014092
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.