Protein Description: poly(A) binding protein interacting protein 1
Gene Name: PAIP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025451: 98%, ENSRNOG00000058580: 98%
Entrez Gene ID: 10605
Uniprot ID: Q9H074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAIP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025451: 98%, ENSRNOG00000058580: 98%
Entrez Gene ID: 10605
Uniprot ID: Q9H074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK |
Documents & Links for Anti PAIP1 pAb (ATL-HPA073653) | |
Datasheet | Anti PAIP1 pAb (ATL-HPA073653) Datasheet (External Link) |
Vendor Page | Anti PAIP1 pAb (ATL-HPA073653) at Atlas |
Documents & Links for Anti PAIP1 pAb (ATL-HPA073653) | |
Datasheet | Anti PAIP1 pAb (ATL-HPA073653) Datasheet (External Link) |
Vendor Page | Anti PAIP1 pAb (ATL-HPA073653) |