Anti PACSIN1 pAb (ATL-HPA055491 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055491-100

• 
• 
• 

Protein Description: protein kinase C and casein kinase substrate in neurons 1
Gene Name: PACSIN1
Alternative Gene Name: SDPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040276: 92%, ENSRNOG00000054603: 94%
Entrez Gene ID: 29993
Uniprot ID: Q9BY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN
• Gene Sequence: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN
• Gene ID - Mouse: ENSMUSG00000040276
• Gene ID - Rat: ENSRNOG00000054603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.