Protein Description: PARK2 co-regulated
Gene Name: PACRG
Alternative Gene Name: FLJ32724, Glup, HAK005771, PARK2CRG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037196: 94%, ENSRNOG00000008299: 29%
Entrez Gene ID: 135138
Uniprot ID: Q96M98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PACRG
Alternative Gene Name: FLJ32724, Glup, HAK005771, PARK2CRG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037196: 94%, ENSRNOG00000008299: 29%
Entrez Gene ID: 135138
Uniprot ID: Q96M98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF |
Documents & Links for Anti PACRG pAb (ATL-HPA066293 w/enhanced validation) | |
Datasheet | Anti PACRG pAb (ATL-HPA066293 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PACRG pAb (ATL-HPA066293 w/enhanced validation) at Atlas |
Documents & Links for Anti PACRG pAb (ATL-HPA066293 w/enhanced validation) | |
Datasheet | Anti PACRG pAb (ATL-HPA066293 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PACRG pAb (ATL-HPA066293 w/enhanced validation) |