Protein Description: purinergic receptor P2X, ligand gated ion channel, 5
Gene Name: P2RX5
Alternative Gene Name: LRH-1, P2X5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005950: 74%, ENSRNOG00000019208: 74%
Entrez Gene ID: 5026
Uniprot ID: Q93086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: P2RX5
Alternative Gene Name: LRH-1, P2X5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005950: 74%, ENSRNOG00000019208: 74%
Entrez Gene ID: 5026
Uniprot ID: Q93086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE |
| Documents & Links for Anti P2RX5 pAb (ATL-HPA067827) | |
| Datasheet | Anti P2RX5 pAb (ATL-HPA067827) Datasheet (External Link) |
| Vendor Page | Anti P2RX5 pAb (ATL-HPA067827) at Atlas |
| Documents & Links for Anti P2RX5 pAb (ATL-HPA067827) | |
| Datasheet | Anti P2RX5 pAb (ATL-HPA067827) Datasheet (External Link) |
| Vendor Page | Anti P2RX5 pAb (ATL-HPA067827) |