Anti P2RX5 pAb (ATL-HPA067827)

Atlas Antibodies

SKU:
ATL-HPA067827-25
  • Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: purinergic receptor P2X, ligand gated ion channel, 5
Gene Name: P2RX5
Alternative Gene Name: LRH-1, P2X5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005950: 74%, ENSRNOG00000019208: 74%
Entrez Gene ID: 5026
Uniprot ID: Q93086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE
Gene Sequence TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE
Gene ID - Mouse ENSMUSG00000005950
Gene ID - Rat ENSRNOG00000019208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti P2RX5 pAb (ATL-HPA067827)
Datasheet Anti P2RX5 pAb (ATL-HPA067827) Datasheet (External Link)
Vendor Page Anti P2RX5 pAb (ATL-HPA067827) at Atlas Antibodies

Documents & Links for Anti P2RX5 pAb (ATL-HPA067827)
Datasheet Anti P2RX5 pAb (ATL-HPA067827) Datasheet (External Link)
Vendor Page Anti P2RX5 pAb (ATL-HPA067827)