Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039494-25
  • Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA039494 antibody. Corresponding P2RX4 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
  • Western blot analysis in human cell line SK-MEL-30.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: purinergic receptor P2X, ligand-gated ion channel, 4
Gene Name: P2RX4
Alternative Gene Name: P2X4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029470: 83%, ENSRNOG00000001300: 77%
Entrez Gene ID: 5025
Uniprot ID: Q99571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YCMKKRLYYREKKYKYVEDYEQGLASELDQ
Gene Sequence YCMKKRLYYREKKYKYVEDYEQGLASELDQ
Gene ID - Mouse ENSMUSG00000029470
Gene ID - Rat ENSRNOG00000001300
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation)
Datasheet Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation)
Datasheet Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation)



Citations for Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) – 2 Found
Walenta, Lena; Fleck, David; Fröhlich, Thomas; von Eysmondt, Hendrik; Arnold, Georg J; Spehr, Jennifer; Schwarzer, J Ullrich; Köhn, Frank-Michael; Spehr, Marc; Mayerhofer, Artur. ATP-mediated Events in Peritubular Cells Contribute to Sterile Testicular Inflammation. Scientific Reports. 2018;8(1):1431.  PubMed
George, Jimmy; Cunha, Rodrigo A; Mulle, Christophe; Amédée, Thierry. Microglia-derived purines modulate mossy fibre synaptic transmission and plasticity through P2X4 and A1 receptors. The European Journal Of Neuroscience. 2016;43(10):1366-78.  PubMed