Protein Description: purinergic receptor P2X, ligand-gated ion channel, 4
Gene Name: P2RX4
Alternative Gene Name: P2X4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029470: 83%, ENSRNOG00000001300: 77%
Entrez Gene ID: 5025
Uniprot ID: Q99571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: P2RX4
Alternative Gene Name: P2X4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029470: 83%, ENSRNOG00000001300: 77%
Entrez Gene ID: 5025
Uniprot ID: Q99571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YCMKKRLYYREKKYKYVEDYEQGLASELDQ |
| Documents & Links for Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) | |
| Datasheet | Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) at Atlas |
| Documents & Links for Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) | |
| Datasheet | Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) |
| Citations for Anti P2RX4 pAb (ATL-HPA039494 w/enhanced validation) – 2 Found |
| Walenta, Lena; Fleck, David; Fröhlich, Thomas; von Eysmondt, Hendrik; Arnold, Georg J; Spehr, Jennifer; Schwarzer, J Ullrich; Köhn, Frank-Michael; Spehr, Marc; Mayerhofer, Artur. ATP-mediated Events in Peritubular Cells Contribute to Sterile Testicular Inflammation. Scientific Reports. 2018;8(1):1431. PubMed |
| George, Jimmy; Cunha, Rodrigo A; Mulle, Christophe; Amédée, Thierry. Microglia-derived purines modulate mossy fibre synaptic transmission and plasticity through P2X4 and A1 receptors. The European Journal Of Neuroscience. 2016;43(10):1366-78. PubMed |