Anti OXNAD1 pAb (ATL-HPA059160)
Atlas Antibodies
- SKU:
- ATL-HPA059160-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: oxidoreductase NAD-binding domain containing 1
Gene Name: OXNAD1
Alternative Gene Name: MGC15763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021906: 81%, ENSRNOG00000019760: 85%
Entrez Gene ID: 92106
Uniprot ID: Q96HP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OXNAD1
Alternative Gene Name: MGC15763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021906: 81%, ENSRNOG00000019760: 85%
Entrez Gene ID: 92106
Uniprot ID: Q96HP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFP |
Gene Sequence | PQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFP |
Gene ID - Mouse | ENSMUSG00000021906 |
Gene ID - Rat | ENSRNOG00000019760 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti OXNAD1 pAb (ATL-HPA059160) | |
Datasheet | Anti OXNAD1 pAb (ATL-HPA059160) Datasheet (External Link) |
Vendor Page | Anti OXNAD1 pAb (ATL-HPA059160) at Atlas Antibodies |
Documents & Links for Anti OXNAD1 pAb (ATL-HPA059160) | |
Datasheet | Anti OXNAD1 pAb (ATL-HPA059160) Datasheet (External Link) |
Vendor Page | Anti OXNAD1 pAb (ATL-HPA059160) |