Anti OXNAD1 pAb (ATL-HPA059160)

Atlas Antibodies

SKU: ATL-HPA059160-25

• 

Product Description

Protein Description: oxidoreductase NAD-binding domain containing 1
Gene Name: OXNAD1
Alternative Gene Name: MGC15763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021906: 81%, ENSRNOG00000019760: 85%
Entrez Gene ID: 92106
Uniprot ID: Q96HP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFP
• Gene Sequence: PQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFP
• Gene ID - Mouse: ENSMUSG00000021906
• Gene ID - Rat: ENSRNOG00000019760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links