Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061425-25

• 
• 

Protein Description: 3-oxoacid CoA transferase 1
Gene Name: OXCT1
Alternative Gene Name: OXCT, SCOT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022186: 72%, ENSRNOG00000043094: 69%
Entrez Gene ID: 5019
Uniprot ID: P55809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
• Gene Sequence: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
• Gene ID - Mouse: ENSMUSG00000022186
• Gene ID - Rat: ENSRNOG00000043094
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.