Anti OTUD6A pAb (ATL-HPA053304 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053304-25

• 
• 

Protein Description: OTU deubiquitinase 6A
Gene Name: OTUD6A
Alternative Gene Name: DUBA2, FLJ25831, HSHIN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051582: 53%, ENSRNOG00000042687: 51%
Entrez Gene ID: 139562
Uniprot ID: Q7L8S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEE
• Gene Sequence: HRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEE
• Gene ID - Mouse: ENSMUSG00000051582
• Gene ID - Rat: ENSRNOG00000042687
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OTUD6A pAb (ATL-HPA053304 w/enhanced validation) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.