Protein Description: osteoclast associated, immunoglobulin-like receptor
Gene Name: OSCAR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054594: 73%, ENSRNOG00000055716: 68%
Entrez Gene ID: 126014
Uniprot ID: Q8IYS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OSCAR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054594: 73%, ENSRNOG00000055716: 68%
Entrez Gene ID: 126014
Uniprot ID: Q8IYS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH |
Documents & Links for Anti OSCAR pAb (ATL-HPA073996) | |
Datasheet | Anti OSCAR pAb (ATL-HPA073996) Datasheet (External Link) |
Vendor Page | Anti OSCAR pAb (ATL-HPA073996) at Atlas |
Documents & Links for Anti OSCAR pAb (ATL-HPA073996) | |
Datasheet | Anti OSCAR pAb (ATL-HPA073996) Datasheet (External Link) |
Vendor Page | Anti OSCAR pAb (ATL-HPA073996) |