Anti OSCAR pAb (ATL-HPA073996)

Atlas Antibodies

SKU: ATL-HPA073996-25

• 

Product Description

Protein Description: osteoclast associated, immunoglobulin-like receptor
Gene Name: OSCAR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054594: 73%, ENSRNOG00000055716: 68%
Entrez Gene ID: 126014
Uniprot ID: Q8IYS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
• Gene Sequence: VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
• Gene ID - Mouse: ENSMUSG00000054594
• Gene ID - Rat: ENSRNOG00000055716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links