Anti OSBPL7 pAb (ATL-HPA053083)

Atlas Antibodies

SKU:
ATL-HPA053083-100
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: oxysterol binding protein-like 7
Gene Name: OSBPL7
Alternative Gene Name: MGC71150, ORP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038534: 90%, ENSRNOG00000009473: 88%
Entrez Gene ID: 114881
Uniprot ID: Q9BZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQLRDMHQGSELSRMGVSEASTGQRRLHSLSTSSDTTADSFSSLNPEEQEALYMKGRELTPQLSQTSILSLADSHTEF
Gene Sequence DQLRDMHQGSELSRMGVSEASTGQRRLHSLSTSSDTTADSFSSLNPEEQEALYMKGRELTPQLSQTSILSLADSHTEF
Gene ID - Mouse ENSMUSG00000038534
Gene ID - Rat ENSRNOG00000009473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti OSBPL7 pAb (ATL-HPA053083)
Datasheet Anti OSBPL7 pAb (ATL-HPA053083) Datasheet (External Link)
Vendor Page Anti OSBPL7 pAb (ATL-HPA053083) at Atlas Antibodies

Documents & Links for Anti OSBPL7 pAb (ATL-HPA053083)
Datasheet Anti OSBPL7 pAb (ATL-HPA053083) Datasheet (External Link)
Vendor Page Anti OSBPL7 pAb (ATL-HPA053083)