Anti OSBPL5 pAb (ATL-HPA058727 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058727-25
  • Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and OSBPL5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407938).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: oxysterol binding protein-like 5
Gene Name: OSBPL5
Alternative Gene Name: KIAA1534, ORP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037606: 80%, ENSRNOG00000020713: 80%
Entrez Gene ID: 114879
Uniprot ID: Q9H0X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL
Gene Sequence LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL
Gene ID - Mouse ENSMUSG00000037606
Gene ID - Rat ENSRNOG00000020713
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti OSBPL5 pAb (ATL-HPA058727 w/enhanced validation)
Datasheet Anti OSBPL5 pAb (ATL-HPA058727 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OSBPL5 pAb (ATL-HPA058727 w/enhanced validation)