Anti OSBPL3 pAb (ATL-HPA048401)

Atlas Antibodies

SKU: ATL-HPA048401-25

• 

Protein Description: oxysterol binding protein-like 3
Gene Name: OSBPL3
Alternative Gene Name: KIAA0704, ORP-3, ORP3, OSBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029822: 83%, ENSRNOG00000010011: 82%
Entrez Gene ID: 26031
Uniprot ID: Q9H4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINA
• Gene Sequence: FPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINA
• Gene ID - Mouse: ENSMUSG00000029822
• Gene ID - Rat: ENSRNOG00000010011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.