Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA053748-25
  • Immunohistochemistry analysis in human testis and pancreas tissues using Anti-ORC3 antibody. Corresponding ORC3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: origin recognition complex, subunit 3
Gene Name: ORC3
Alternative Gene Name: IMAGE50150, LATHEO, ORC3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040044: 71%, ENSRNOG00000008314: 76%
Entrez Gene ID: 23595
Uniprot ID: Q9UBD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD
Gene Sequence NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD
Gene ID - Mouse ENSMUSG00000040044
Gene ID - Rat ENSRNOG00000008314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation)
Datasheet Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation)
Datasheet Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ORC3 pAb (ATL-HPA053748 w/enhanced validation)