Anti OR5T3 pAb (ATL-HPA044986)

Atlas Antibodies

SKU: ATL-HPA044986-25

• 

Protein Description: olfactory receptor, family 5, subfamily T, member 3
Gene Name: OR5T3
Alternative Gene Name: OR5T3Q
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047969: 33%, ENSRNOG00000010474: 35%
Entrez Gene ID: 390154
Uniprot ID: Q8NGG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF
• Gene Sequence: STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF
• Gene ID - Mouse: ENSMUSG00000047969
• Gene ID - Rat: ENSRNOG00000010474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.