Anti OR2D3 pAb (ATL-HPA052551)

Atlas Antibodies

SKU: ATL-HPA052551-25

• 

Protein Description: olfactory receptor, family 2, subfamily D, member 3
Gene Name: OR2D3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062553: 47%, ENSRNOG00000047623: 50%
Entrez Gene ID: 120775
Uniprot ID: Q8NGH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLCQTGKQAKISMGEENQTFVSKFIFLGLSQDLQ
• Gene Sequence: FLCQTGKQAKISMGEENQTFVSKFIFLGLSQDLQ
• Gene ID - Mouse: ENSMUSG00000062553
• Gene ID - Rat: ENSRNOG00000047623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.