Anti OOSP2 pAb (ATL-HPA050914 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050914-25

• 

Protein Description: oocyte secreted protein 2
Gene Name: OOSP2
Alternative Gene Name: FLJ36198, PLAC1L, TMEM122
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055895: 52%, ENSRNOG00000036624: 52%
Entrez Gene ID: 219990
Uniprot ID: Q86WS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLL
• Gene Sequence: ISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLL
• Gene ID - Mouse: ENSMUSG00000055895
• Gene ID - Rat: ENSRNOG00000036624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.