Anti OMD pAb (ATL-HPA069948)
Atlas Antibodies
- SKU:
- ATL-HPA069948-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: OMD
Alternative Gene Name: osteoadherin, SLRR2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048368: 85%, ENSRNOG00000039560: 86%
Entrez Gene ID: 4958
Uniprot ID: Q99983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP |
Gene Sequence | PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP |
Gene ID - Mouse | ENSMUSG00000048368 |
Gene ID - Rat | ENSRNOG00000039560 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OMD pAb (ATL-HPA069948) | |
Datasheet | Anti OMD pAb (ATL-HPA069948) Datasheet (External Link) |
Vendor Page | Anti OMD pAb (ATL-HPA069948) at Atlas Antibodies |
Documents & Links for Anti OMD pAb (ATL-HPA069948) | |
Datasheet | Anti OMD pAb (ATL-HPA069948) Datasheet (External Link) |
Vendor Page | Anti OMD pAb (ATL-HPA069948) |