Protein Description: osteomodulin
Gene Name: OMD
Alternative Gene Name: osteoadherin, SLRR2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048368: 85%, ENSRNOG00000039560: 86%
Entrez Gene ID: 4958
Uniprot ID: Q99983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OMD
Alternative Gene Name: osteoadherin, SLRR2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048368: 85%, ENSRNOG00000039560: 86%
Entrez Gene ID: 4958
Uniprot ID: Q99983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP |
| Documents & Links for Anti OMD pAb (ATL-HPA069948) | |
| Datasheet | Anti OMD pAb (ATL-HPA069948) Datasheet (External Link) |
| Vendor Page | Anti OMD pAb (ATL-HPA069948) at Atlas |
| Documents & Links for Anti OMD pAb (ATL-HPA069948) | |
| Datasheet | Anti OMD pAb (ATL-HPA069948) Datasheet (External Link) |
| Vendor Page | Anti OMD pAb (ATL-HPA069948) |