Anti OLFM1 pAb (ATL-HPA057444)
Atlas Antibodies
- SKU:
- ATL-HPA057444-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: OLFM1
Alternative Gene Name: AMY, NOE1, NOELIN, OlfA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026833: 98%, ENSRNOG00000009862: 98%
Entrez Gene ID: 10439
Uniprot ID: Q99784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDE |
| Gene Sequence | IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDE |
| Gene ID - Mouse | ENSMUSG00000026833 |
| Gene ID - Rat | ENSRNOG00000009862 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OLFM1 pAb (ATL-HPA057444) | |
| Datasheet | Anti OLFM1 pAb (ATL-HPA057444) Datasheet (External Link) |
| Vendor Page | Anti OLFM1 pAb (ATL-HPA057444) at Atlas Antibodies |
| Documents & Links for Anti OLFM1 pAb (ATL-HPA057444) | |
| Datasheet | Anti OLFM1 pAb (ATL-HPA057444) Datasheet (External Link) |
| Vendor Page | Anti OLFM1 pAb (ATL-HPA057444) |
| Citations for Anti OLFM1 pAb (ATL-HPA057444) – 1 Found |
| Ben Amar, Dounia; Thoinet, Karine; Villalard, Benjamin; Imbaud, Olivier; Costechareyre, Clélia; Jarrosson, Loraine; Reynaud, Florie; Novion Ducassou, Julia; Couté, Yohann; Brunet, Jean-François; Combaret, Valérie; Corradini, Nadège; Delloye-Bourgeois, Céline; Castellani, Valérie. Environmental cues from neural crest derivatives act as metastatic triggers in an embryonic neuroblastoma model. Nature Communications. 2022;13(1):2549. PubMed |