Anti OIP5 pAb (ATL-HPA052271 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052271-25

• 
• 
• 

Protein Description: Opa interacting protein 5
Gene Name: OIP5
Alternative Gene Name: CT86, hMIS18beta, MIS18B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072980: 76%, ENSRNOG00000057458: 80%
Entrez Gene ID: 11339
Uniprot ID: O43482
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
• Gene Sequence: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
• Gene ID - Mouse: ENSMUSG00000072980
• Gene ID - Rat: ENSRNOG00000057458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OIP5 pAb (ATL-HPA052271 w/enhanced validation) – 1 Found

Pan, Dongqing; Klare, Kerstin; Petrovic, Arsen; Take, Annika; Walstein, Kai; Singh, Priyanka; Rondelet, Arnaud; Bird, Alexander W; Musacchio, Andrea. CDK-regulated dimerization of M18BP1 on a Mis18 hexamer is necessary for CENP-A loading. Elife. 2017;6( 28059702)