Anti OGFOD3 pAb (ATL-HPA052099 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052099-25

• 
• 
• 

Protein Description: 2-oxoglutarate and iron-dependent oxygenase domain containing 3
Gene Name: OGFOD3
Alternative Gene Name: C17orf101, FLJ22222
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025169: 93%, ENSRNOG00000036668: 91%
Entrez Gene ID: 79701
Uniprot ID: Q6PK18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGVTDVVITREEAERIRSVAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRLYREVRQKVQLTIAEAFGISASSLHLTKPTFFSRINSTEARTAHDEYWHAHVDKVTYGS
• Gene Sequence: RGVTDVVITREEAERIRSVAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRLYREVRQKVQLTIAEAFGISASSLHLTKPTFFSRINSTEARTAHDEYWHAHVDKVTYGS
• Gene ID - Mouse: ENSMUSG00000025169
• Gene ID - Rat: ENSRNOG00000036668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.