Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA072129-25

• 

Protein Description: outer dense fiber of sperm tails 4
Gene Name: ODF4
Alternative Gene Name: CT136, OPPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032921: 35%, ENSRNOG00000004225: 37%
Entrez Gene ID: 146852
Uniprot ID: Q2M2E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK
• Gene Sequence: FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK
• Gene ID - Mouse: ENSMUSG00000032921
• Gene ID - Rat: ENSRNOG00000004225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.