Protein Description: outer dense fiber of sperm tails 4
Gene Name: ODF4
Alternative Gene Name: CT136, OPPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032921: 35%, ENSRNOG00000004225: 37%
Entrez Gene ID: 146852
Uniprot ID: Q2M2E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ODF4
Alternative Gene Name: CT136, OPPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032921: 35%, ENSRNOG00000004225: 37%
Entrez Gene ID: 146852
Uniprot ID: Q2M2E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK |
Documents & Links for Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation) | |
Datasheet | Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation) at Atlas |
Documents & Links for Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation) | |
Datasheet | Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ODF4 pAb (ATL-HPA072129 w/enhanced validation) |