Anti ODF2 pAb (ATL-HPA001874 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001874-25

Protein Description: outer dense fiber of sperm tails 2
Gene Name: ODF2
Alternative Gene Name: CT134, ODF84
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026790: 99%, ENSRNOG00000014584: 99%
Entrez Gene ID: 4957
Uniprot ID: Q5BJF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
• Gene Sequence: HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
• Gene ID - Mouse: ENSMUSG00000026790
• Gene ID - Rat: ENSRNOG00000014584
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ODF2 pAb (ATL-HPA001874 w/enhanced validation) – 10 Found

Cortés, Claudio R; McInerney-Leo, Aideen M; Vogel, Ida; Rondón Galeano, Maria C; Leo, Paul J; Harris, Jessica E; Anderson, Lisa K; Keith, Patricia A; Brown, Matthew A; Ramsing, Mette; Duncan, Emma L; Zankl, Andreas; Wicking, Carol. Mutations in human C2CD3 cause skeletal dysplasia and provide new insights into phenotypic and cellular consequences of altered C2CD3 function. Scientific Reports. 2016;6( 27094867):24083. 

Mazo, Gregory; Soplop, Nadine; Wang, Won-Jing; Uryu, Kunihiro; Tsou, Meng Fu Bryan. Spatial Control of Primary Ciliogenesis by Subdistal Appendages Alters Sensation-Associated Properties of Cilia. Developmental Cell. 2016;39(4):424-437. 

Loukil, Abdelhalim; Tormanen, Kati; Sütterlin, Christine. The daughter centriole controls ciliogenesis by regulating Neurl-4 localization at the centrosome. The Journal Of Cell Biology. 2017;216(5):1287-1300. 

Baron Gaillard, Carole L; Pallesi-Pocachard, Emilie; Massey-Harroche, Dominique; Richard, Fabrice; Arsanto, Jean-Pierre; Chauvin, Jean-Paul; Lecine, Patrick; Krämer, Helmut; Borg, Jean-Paul; Le Bivic, André. Hook2 is involved in the morphogenesis of the primary cilium. Molecular Biology Of The Cell. 2011;22(23):4549-62. 

Asante, David; Maccarthy-Morrogh, Lucy; Townley, Anna K; Weiss, Matthew A; Katayama, Kentaro; Palmer, Krysten J; Suzuki, Hiroetsu; Westlake, Chris J; Stephens, David J. A role for the Golgi matrix protein giantin in ciliogenesis through control of the localization of dynein-2. Journal Of Cell Science. 2013;126(Pt 22):5189-97. 

Asante, David; Stevenson, Nicola L; Stephens, David J. Subunit composition of the human cytoplasmic dynein-2 complex. Journal Of Cell Science. 2014;127(Pt 21):4774-87. 

Chong, Weng Man; Wang, Won-Jing; Lo, Chien-Hui; Chiu, Tzu-Yuan; Chang, Ting-Jui; Liu, You-Pi; Tanos, Barbara; Mazo, Gregory; Tsou, Meng-Fu Bryan; Jane, Wann-Neng; Yang, T Tony; Liao, Jung-Chi. Super-resolution microscopy reveals coupling between mammalian centriole subdistal appendages and distal appendages. Elife. 2020;9( 32242819) 

Miyamoto, Tatsuo; Hosoba, Kosuke; Itabashi, Takeshi; Iwane, Atsuko H; Akutsu, Silvia Natsuko; Ochiai, Hiroshi; Saito, Yumiko; Yamamoto, Takashi; Matsuura, Shinya. Insufficiency of ciliary cholesterol in hereditary Zellweger syndrome. The Embo Journal. 2020;39(12):e103499. 

Ryu, Hyunchul; Lee, Haeryung; Lee, Jiyeon; Noh, Hyuna; Shin, Miram; Kumar, Vijay; Hong, Sejeong; Kim, Jaebong; Park, Soochul. The molecular dynamics of subdistal appendages in multi-ciliated cells. Nature Communications. 2021;12(1):612. 

Mikhailik, Anatoly; Michurina, Tatyana V; Dikranian, Krikor; Hearn, Stephen; Maxakov, Vladimir I; Siller, Saul S; Takemaru, Ken-Ichi; Enikolopov, Grigori; Peunova, Natalia. nNOS regulates ciliated cell polarity, ciliary beat frequency, and directional flow in mouse trachea. Life Science Alliance. 2021;4(5)