Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA065801-25

• 

Product Description

Protein Description: obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
Gene Name: OBSCN
Alternative Gene Name: ARHGEF30, KIAA1556, KIAA1639, UNC89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061462: 57%, ENSRNOG00000058068: 58%
Entrez Gene ID: 84033
Uniprot ID: Q5VST9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVEETIEVRVKKMGPQGVSPTTEVPRSSSGHLFTLPGATPGGDPNSNNSNNKLLAQEAWAQGTAMVGVREPLVFRVDARGSVDWAASGMGS
• Gene Sequence: EVEETIEVRVKKMGPQGVSPTTEVPRSSSGHLFTLPGATPGGDPNSNNSNNKLLAQEAWAQGTAMVGVREPLVFRVDARGSVDWAASGMGS
• Gene ID - Mouse: ENSMUSG00000061462
• Gene ID - Rat: ENSRNOG00000058068
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links