Protein Description: obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
Gene Name: OBSCN
Alternative Gene Name: ARHGEF30, KIAA1556, KIAA1639, UNC89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061462: 57%, ENSRNOG00000058068: 58%
Entrez Gene ID: 84033
Uniprot ID: Q5VST9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OBSCN
Alternative Gene Name: ARHGEF30, KIAA1556, KIAA1639, UNC89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061462: 57%, ENSRNOG00000058068: 58%
Entrez Gene ID: 84033
Uniprot ID: Q5VST9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EVEETIEVRVKKMGPQGVSPTTEVPRSSSGHLFTLPGATPGGDPNSNNSNNKLLAQEAWAQGTAMVGVREPLVFRVDARGSVDWAASGMGS |
| Documents & Links for Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation) | |
| Datasheet | Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation) at Atlas |
| Documents & Links for Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation) | |
| Datasheet | Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OBSCN pAb (ATL-HPA065801 w/enhanced validation) |