Protein Description: ornithine aminotransferase
Gene Name: OAT
Alternative Gene Name: HOGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030934: 95%, ENSRNOG00000016807: 97%
Entrez Gene ID: 4942
Uniprot ID: P04181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OAT
Alternative Gene Name: HOGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030934: 95%, ENSRNOG00000016807: 97%
Entrez Gene ID: 4942
Uniprot ID: P04181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGST |
| Documents & Links for Anti OAT pAb (ATL-HPA064742) | |
| Datasheet | Anti OAT pAb (ATL-HPA064742) Datasheet (External Link) |
| Vendor Page | Anti OAT pAb (ATL-HPA064742) at Atlas |
| Documents & Links for Anti OAT pAb (ATL-HPA064742) | |
| Datasheet | Anti OAT pAb (ATL-HPA064742) Datasheet (External Link) |
| Vendor Page | Anti OAT pAb (ATL-HPA064742) |