Anti OAF pAb (ATL-HPA047412)

Atlas Antibodies

SKU:
ATL-HPA047412-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: OAF homolog (Drosophila)
Gene Name: OAF
Alternative Gene Name: MGC52117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032014: 87%, ENSRNOG00000009243: 83%
Entrez Gene ID: 220323
Uniprot ID: Q86UD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ
Gene Sequence RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ
Gene ID - Mouse ENSMUSG00000032014
Gene ID - Rat ENSRNOG00000009243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti OAF pAb (ATL-HPA047412)
Datasheet Anti OAF pAb (ATL-HPA047412) Datasheet (External Link)
Vendor Page Anti OAF pAb (ATL-HPA047412) at Atlas Antibodies

Documents & Links for Anti OAF pAb (ATL-HPA047412)
Datasheet Anti OAF pAb (ATL-HPA047412) Datasheet (External Link)
Vendor Page Anti OAF pAb (ATL-HPA047412)