Protein Description: neurexophilin 3
Gene Name: NXPH3
Alternative Gene Name: NPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046719: 90%, ENSRNOG00000005185: 92%
Entrez Gene ID: 11248
Uniprot ID: O95157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NXPH3
Alternative Gene Name: NPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046719: 90%, ENSRNOG00000005185: 92%
Entrez Gene ID: 11248
Uniprot ID: O95157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPNH |
| Documents & Links for Anti NXPH3 pAb (ATL-HPA073819) | |
| Datasheet | Anti NXPH3 pAb (ATL-HPA073819) Datasheet (External Link) |
| Vendor Page | Anti NXPH3 pAb (ATL-HPA073819) at Atlas |
| Documents & Links for Anti NXPH3 pAb (ATL-HPA073819) | |
| Datasheet | Anti NXPH3 pAb (ATL-HPA073819) Datasheet (External Link) |
| Vendor Page | Anti NXPH3 pAb (ATL-HPA073819) |