Anti NXPE1 pAb (ATL-HPA049133 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049133-25

• 
• 

Protein Description: neurexophilin and PC-esterase domain family, member 1
Gene Name: NXPE1
Alternative Gene Name: FAM55A, MGC34290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032028: 43%, ENSRNOG00000027730: 50%
Entrez Gene ID: 120400
Uniprot ID: Q8N323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YMTTRNREVSYLTDKENSLFHRSKVGVEMMKDRKHIDVTNCNKREKIEETCQVGMKPPVP
• Gene Sequence: YMTTRNREVSYLTDKENSLFHRSKVGVEMMKDRKHIDVTNCNKREKIEETCQVGMKPPVP
• Gene ID - Mouse: ENSMUSG00000032028
• Gene ID - Rat: ENSRNOG00000027730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.