Anti NXF1 pAb (ATL-HPA061593)

Atlas Antibodies

Catalog No.:
ATL-HPA061593-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear RNA export factor 1
Gene Name: NXF1
Alternative Gene Name: DKFZp667O0311, Mex67, TAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010097: 86%, ENSRNOG00000019069: 91%
Entrez Gene ID: 10482
Uniprot ID: Q9UBU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
Gene Sequence IRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
Gene ID - Mouse ENSMUSG00000010097
Gene ID - Rat ENSRNOG00000019069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NXF1 pAb (ATL-HPA061593)
Datasheet Anti NXF1 pAb (ATL-HPA061593) Datasheet (External Link)
Vendor Page Anti NXF1 pAb (ATL-HPA061593) at Atlas Antibodies

Documents & Links for Anti NXF1 pAb (ATL-HPA061593)
Datasheet Anti NXF1 pAb (ATL-HPA061593) Datasheet (External Link)
Vendor Page Anti NXF1 pAb (ATL-HPA061593)