Anti NUP85 pAb (ATL-HPA061910)

Atlas Antibodies

SKU:
ATL-HPA061910-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nucleoporin 85kDa
Gene Name: NUP85
Alternative Gene Name: FLJ12549, NUP75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020739: 83%, ENSRNOG00000003673: 89%
Entrez Gene ID: 79902
Uniprot ID: Q9BW27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ
Gene Sequence ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ
Gene ID - Mouse ENSMUSG00000020739
Gene ID - Rat ENSRNOG00000003673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NUP85 pAb (ATL-HPA061910)
Datasheet Anti NUP85 pAb (ATL-HPA061910) Datasheet (External Link)
Vendor Page Anti NUP85 pAb (ATL-HPA061910) at Atlas Antibodies

Documents & Links for Anti NUP85 pAb (ATL-HPA061910)
Datasheet Anti NUP85 pAb (ATL-HPA061910) Datasheet (External Link)
Vendor Page Anti NUP85 pAb (ATL-HPA061910)