Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048328-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
  • Western blot analysis using Anti-NUP50 antibody HPA048328 (A) shows similar pattern to independent antibody HPA047162 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nucleoporin 50kDa
Gene Name: NUP50
Alternative Gene Name: NPAP60L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016619: 83%, ENSRNOG00000013423: 83%
Entrez Gene ID: 10762
Uniprot ID: Q9UKX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR
Gene Sequence NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR
Gene ID - Mouse ENSMUSG00000016619
Gene ID - Rat ENSRNOG00000013423
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation)
Datasheet Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation)
Datasheet Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP50 pAb (ATL-HPA048328 w/enhanced validation)