Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047162-25

• 
• 
• 

Protein Description: nucleoporin 50kDa
Gene Name: NUP50
Alternative Gene Name: NPAP60L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016619: 76%, ENSRNOG00000013423: 71%
Entrez Gene ID: 10762
Uniprot ID: Q9UKX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD
• Gene Sequence: DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD
• Gene ID - Mouse: ENSMUSG00000016619
• Gene ID - Rat: ENSRNOG00000013423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.