Anti NUP210 pAb (ATL-HPA066888)
Atlas Antibodies
- SKU:
- ATL-HPA066888-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NUP210
Alternative Gene Name: FLJ22389, GP210, KIAA0906, POM210
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030091: 81%, ENSRNOG00000005390: 81%
Entrez Gene ID: 23225
Uniprot ID: Q8TEM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTSLEGLSGTWSSSANSILHIDPKTGVAV |
| Gene Sequence | TFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTSLEGLSGTWSSSANSILHIDPKTGVAV |
| Gene ID - Mouse | ENSMUSG00000030091 |
| Gene ID - Rat | ENSRNOG00000005390 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUP210 pAb (ATL-HPA066888) | |
| Datasheet | Anti NUP210 pAb (ATL-HPA066888) Datasheet (External Link) |
| Vendor Page | Anti NUP210 pAb (ATL-HPA066888) at Atlas Antibodies |
| Documents & Links for Anti NUP210 pAb (ATL-HPA066888) | |
| Datasheet | Anti NUP210 pAb (ATL-HPA066888) Datasheet (External Link) |
| Vendor Page | Anti NUP210 pAb (ATL-HPA066888) |
| Citations for Anti NUP210 pAb (ATL-HPA066888) – 1 Found |
| Wurlitzer, Marcus; Möckelmann, Nikolaus; Kriegs, Malte; Vens, Maren; Omidi, Maryam; Hoffer, Konstantin; Bargen, Clara von; Möller-Koop, Christina; Witt, Melanie; Droste, Conrad; Oetting, Agnes; Petersen, Hannes; Busch, Chia-Jung; Münscher, Adrian; Schlüter, Hartmut; Clauditz, Till Sebastian; Rieckmann, Thorsten. Mass Spectrometric Comparison of HPV-Positive and HPV-Negative Oropharyngeal Cancer. Cancers. 2020;12(6) PubMed |