![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101653/181796/atl-hpa076604_anti-nuf2-pab-atl-hpa076604_63464__69193.1681138204.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: NUF2, NDC80 kinetochore complex component
Gene Name: NUF2
Alternative Gene Name: CDCA1, CT106, NUF2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026683: 85%, ENSRNOG00000002711: 85%
Entrez Gene ID: 83540
Uniprot ID: Q9BZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUF2
Alternative Gene Name: CDCA1, CT106, NUF2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026683: 85%, ENSRNOG00000002711: 85%
Entrez Gene ID: 83540
Uniprot ID: Q9BZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE |
| Documents & Links for Anti NUF2 pAb (ATL-HPA076604) | |
| Datasheet | Anti NUF2 pAb (ATL-HPA076604) Datasheet (External Link) |
| Vendor Page | Anti NUF2 pAb (ATL-HPA076604) at Atlas |
| Documents & Links for Anti NUF2 pAb (ATL-HPA076604) | |
| Datasheet | Anti NUF2 pAb (ATL-HPA076604) Datasheet (External Link) |
| Vendor Page | Anti NUF2 pAb (ATL-HPA076604) |
| Citations for Anti NUF2 pAb (ATL-HPA076604) – 1 Found |
| Jiang, Xiaodan; Jiang, Yan; Luo, Senbiao; Sekar, Karthik; Koh, Clara Kai Ting; Deivasigamani, Amudha; Dong, Qingzhe; Zhang, Niankai; Li, Shenling; Hao, Fengyun; Goh, Brian Kim Poh; Ooi, London Lucien; Wang, Yu; Hui, Kam Man. Correlation of NUF2 Overexpression with Poorer Patient Survival in Multiple Cancers. Cancer Research And Treatment. 2021;53(4):944-961. PubMed |