Anti NUF2 pAb (ATL-HPA059692)

Atlas Antibodies

Catalog No.:
ATL-HPA059692-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NUF2, NDC80 kinetochore complex component
Gene Name: NUF2
Alternative Gene Name: CDCA1, CT106, NUF2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026683: 72%, ENSRNOG00000002711: 82%
Entrez Gene ID: 83540
Uniprot ID: Q9BZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
Gene Sequence ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
Gene ID - Mouse ENSMUSG00000026683
Gene ID - Rat ENSRNOG00000002711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUF2 pAb (ATL-HPA059692)
Datasheet Anti NUF2 pAb (ATL-HPA059692) Datasheet (External Link)
Vendor Page Anti NUF2 pAb (ATL-HPA059692) at Atlas Antibodies

Documents & Links for Anti NUF2 pAb (ATL-HPA059692)
Datasheet Anti NUF2 pAb (ATL-HPA059692) Datasheet (External Link)
Vendor Page Anti NUF2 pAb (ATL-HPA059692)