Anti NUDT22 pAb (ATL-HPA053464)

Atlas Antibodies

SKU: ATL-HPA053464-25

• 

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 22
Gene Name: NUDT22
Alternative Gene Name: MGC13045
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037349: 79%, ENSRNOG00000021158: 77%
Entrez Gene ID: 84304
Uniprot ID: Q9BRQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLT
• Gene Sequence: DPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLT
• Gene ID - Mouse: ENSMUSG00000037349
• Gene ID - Rat: ENSRNOG00000021158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.