Anti NUDT14 pAb (ATL-HPA046755)

Atlas Antibodies

SKU: ATL-HPA046755-25

• 

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 14
Gene Name: NUDT14
Alternative Gene Name: UGPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002804: 82%, ENSRNOG00000014362: 85%
Entrez Gene ID: 256281
Uniprot ID: O95848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQ
• Gene Sequence: EAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQ
• Gene ID - Mouse: ENSMUSG00000002804
• Gene ID - Rat: ENSRNOG00000014362
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.