Anti NUDT12 pAb (ATL-HPA045449)

Atlas Antibodies

SKU: ATL-HPA045449-25

• 

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 12
Gene Name: NUDT12
Alternative Gene Name: DKFZP761I172
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024228: 96%, ENSRNOG00000022576: 95%
Entrez Gene ID: 83594
Uniprot ID: Q9BQG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIA
• Gene Sequence: VRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIA
• Gene ID - Mouse: ENSMUSG00000024228
• Gene ID - Rat: ENSRNOG00000022576
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.