Protein Description: neurotensin
Gene Name: NTS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019890: 75%, ENSRNOG00000004179: 70%
Entrez Gene ID: 4922
Uniprot ID: P30990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NTS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019890: 75%, ENSRNOG00000004179: 70%
Entrez Gene ID: 4922
Uniprot ID: P30990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALD |
| Documents & Links for Anti NTS pAb (ATL-HPA071012) | |
| Datasheet | Anti NTS pAb (ATL-HPA071012) Datasheet (External Link) |
| Vendor Page | Anti NTS pAb (ATL-HPA071012) at Atlas |
| Documents & Links for Anti NTS pAb (ATL-HPA071012) | |
| Datasheet | Anti NTS pAb (ATL-HPA071012) Datasheet (External Link) |
| Vendor Page | Anti NTS pAb (ATL-HPA071012) |