Anti NTPCR pAb (ATL-HPA054304)

Atlas Antibodies

SKU:
ATL-HPA054304-25
  • Immunohistochemical staining of human adrenal gland shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nucleoside-triphosphatase, cancer-related
Gene Name: NTPCR
Alternative Gene Name: C1orf57, HCR-NTPase, MGC13186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031851: 83%, ENSRNOG00000019922: 81%
Entrez Gene ID: 84284
Uniprot ID: Q9BSD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
Gene Sequence PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
Gene ID - Mouse ENSMUSG00000031851
Gene ID - Rat ENSRNOG00000019922
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NTPCR pAb (ATL-HPA054304)
Datasheet Anti NTPCR pAb (ATL-HPA054304) Datasheet (External Link)
Vendor Page Anti NTPCR pAb (ATL-HPA054304) at Atlas Antibodies

Documents & Links for Anti NTPCR pAb (ATL-HPA054304)
Datasheet Anti NTPCR pAb (ATL-HPA054304) Datasheet (External Link)
Vendor Page Anti NTPCR pAb (ATL-HPA054304)