Anti NTNG1 pAb (ATL-HPA065954)

Atlas Antibodies

SKU:
ATL-HPA065954-25
  • Immunofluorescent staining of human cell line BJ shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: netrin G1
Gene Name: NTNG1
Alternative Gene Name: KIAA0976, Lmnt1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059857: 89%, ENSRNOG00000013694: 49%
Entrez Gene ID: 22854
Uniprot ID: Q9Y2I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD
Gene Sequence PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD
Gene ID - Mouse ENSMUSG00000059857
Gene ID - Rat ENSRNOG00000013694
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NTNG1 pAb (ATL-HPA065954)
Datasheet Anti NTNG1 pAb (ATL-HPA065954) Datasheet (External Link)
Vendor Page Anti NTNG1 pAb (ATL-HPA065954) at Atlas Antibodies

Documents & Links for Anti NTNG1 pAb (ATL-HPA065954)
Datasheet Anti NTNG1 pAb (ATL-HPA065954) Datasheet (External Link)
Vendor Page Anti NTNG1 pAb (ATL-HPA065954)