Protein Description: netrin G1
Gene Name: NTNG1
Alternative Gene Name: KIAA0976, Lmnt1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059857: 89%, ENSRNOG00000013694: 49%
Entrez Gene ID: 22854
Uniprot ID: Q9Y2I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NTNG1
Alternative Gene Name: KIAA0976, Lmnt1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059857: 89%, ENSRNOG00000013694: 49%
Entrez Gene ID: 22854
Uniprot ID: Q9Y2I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD |
Documents & Links for Anti NTNG1 pAb (ATL-HPA065954) | |
Datasheet | Anti NTNG1 pAb (ATL-HPA065954) Datasheet (External Link) |
Vendor Page | Anti NTNG1 pAb (ATL-HPA065954) at Atlas |
Documents & Links for Anti NTNG1 pAb (ATL-HPA065954) | |
Datasheet | Anti NTNG1 pAb (ATL-HPA065954) Datasheet (External Link) |
Vendor Page | Anti NTNG1 pAb (ATL-HPA065954) |