Anti NTN3 pAb (ATL-HPA050817)
Atlas Antibodies
- SKU:
- ATL-HPA050817-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NTN3
Alternative Gene Name: NTN2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036473: 81%, ENSRNOG00000006970: 83%
Entrez Gene ID: 4917
Uniprot ID: O00634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV |
Gene Sequence | CVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV |
Gene ID - Mouse | ENSMUSG00000036473 |
Gene ID - Rat | ENSRNOG00000006970 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NTN3 pAb (ATL-HPA050817) | |
Datasheet | Anti NTN3 pAb (ATL-HPA050817) Datasheet (External Link) |
Vendor Page | Anti NTN3 pAb (ATL-HPA050817) at Atlas Antibodies |
Documents & Links for Anti NTN3 pAb (ATL-HPA050817) | |
Datasheet | Anti NTN3 pAb (ATL-HPA050817) Datasheet (External Link) |
Vendor Page | Anti NTN3 pAb (ATL-HPA050817) |