Anti NTN3 pAb (ATL-HPA050817)

Atlas Antibodies

SKU:
ATL-HPA050817-25
  • Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
  • Western blot analysis in human plasma.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: netrin 3
Gene Name: NTN3
Alternative Gene Name: NTN2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036473: 81%, ENSRNOG00000006970: 83%
Entrez Gene ID: 4917
Uniprot ID: O00634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV
Gene Sequence CVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV
Gene ID - Mouse ENSMUSG00000036473
Gene ID - Rat ENSRNOG00000006970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NTN3 pAb (ATL-HPA050817)
Datasheet Anti NTN3 pAb (ATL-HPA050817) Datasheet (External Link)
Vendor Page Anti NTN3 pAb (ATL-HPA050817) at Atlas Antibodies

Documents & Links for Anti NTN3 pAb (ATL-HPA050817)
Datasheet Anti NTN3 pAb (ATL-HPA050817) Datasheet (External Link)
Vendor Page Anti NTN3 pAb (ATL-HPA050817)