Anti NSUN6 pAb (ATL-HPA045902)

Atlas Antibodies

SKU:
ATL-HPA045902-25
  • Immunohistochemical staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
  • Western blot analysis in human cell line K562.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NOP2/Sun domain family, member 6
Gene Name: NSUN6
Alternative Gene Name: ARL5B-AS1, FLJ23743, NOPD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026707: 88%, ENSRNOG00000018520: 88%
Entrez Gene ID: 221078
Uniprot ID: Q8TEA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG
Gene Sequence VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG
Gene ID - Mouse ENSMUSG00000026707
Gene ID - Rat ENSRNOG00000018520
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NSUN6 pAb (ATL-HPA045902)
Datasheet Anti NSUN6 pAb (ATL-HPA045902) Datasheet (External Link)
Vendor Page Anti NSUN6 pAb (ATL-HPA045902) at Atlas Antibodies

Documents & Links for Anti NSUN6 pAb (ATL-HPA045902)
Datasheet Anti NSUN6 pAb (ATL-HPA045902) Datasheet (External Link)
Vendor Page Anti NSUN6 pAb (ATL-HPA045902)



Citations for Anti NSUN6 pAb (ATL-HPA045902) – 1 Found
Yang, Ruimeng; Liang, Xing; Wang, Hui; Guo, Miaomiao; Shen, Hui; Shi, Yongheng; Liu, Qiang; Sun, Yongwei; Yang, Linhua; Zhan, Ming. The RNA methyltransferase NSUN6 suppresses pancreatic cancer development by regulating cell proliferation. Ebiomedicine. 2021;63( 33418496):103195.  PubMed