Anti NSMCE2 pAb (ATL-HPA051614)

Atlas Antibodies

SKU: ATL-HPA051614-25

• 

Protein Description: NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase
Gene Name: NSMCE2
Alternative Gene Name: C8orf36, FLJ32440, MMS21, NSE2, ZMIZ7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059586: 84%, ENSRNOG00000003964: 84%
Entrez Gene ID: 286053
Uniprot ID: Q96MF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
• Gene Sequence: SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
• Gene ID - Mouse: ENSMUSG00000059586
• Gene ID - Rat: ENSRNOG00000003964
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.