Anti NSL1 pAb (ATL-HPA053721)

Atlas Antibodies

SKU:
ATL-HPA053721-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & nuclear speckles.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NSL1, MIS12 kinetochore complex component
Gene Name: NSL1
Alternative Gene Name: C1orf48, DC8, DKFZP566O1646, MIS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062510: 75%, ENSRNOG00000042286: 72%
Entrez Gene ID: 25936
Uniprot ID: Q96IY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGE
Gene Sequence RKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGE
Gene ID - Mouse ENSMUSG00000062510
Gene ID - Rat ENSRNOG00000042286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NSL1 pAb (ATL-HPA053721)
Datasheet Anti NSL1 pAb (ATL-HPA053721) Datasheet (External Link)
Vendor Page Anti NSL1 pAb (ATL-HPA053721) at Atlas Antibodies

Documents & Links for Anti NSL1 pAb (ATL-HPA053721)
Datasheet Anti NSL1 pAb (ATL-HPA053721) Datasheet (External Link)
Vendor Page Anti NSL1 pAb (ATL-HPA053721)